We can offer a discount on bulk orders. Please contact our sales team for further inquiry.
Product Infomation
Product Name Recombinant Human Transforming Growth Factor Beta 2
Catalog Number TGF-004
Size 1µg;5µg;100µg
Description TGFB2 consists of two identical 118-amino acid polypeptide chains linked by a disulfide bond. TGFB2 belongs to a family of five related cytokines that are widely expressed in both normal and tumor cells, highlighting the importance of these homodimeric proteins as multifunctional regulators of cellular activity. The three mammalian subtypes of TGF-β (TGFβ1, TGFβ2, and TGFβ3) signal through the same receptors and stimulate similar biological responses. They are involved in physiological processes such as embryogenesis, tissue remodeling, and wound healing.
Application This product can be used for research on modulating immune responses and fibrosis in tissue engineering with human TGF-β2.
Molecular Weight 27.08 kDa
Species Human
Source Nicotiana benthamiana
Appearance Sterile-filtered white lyophilized powder
Purity ≥ 97% by SDS-PAGE
Activity The biological activity of TGFB2 was determined in vitro by its ability to inhibit the proliferation of mink lung epithelial cells (Mv1Lu). The ED₅₀ was < 40 ng/mL, corresponding to a specific activity of 25,000 units/mg.
Redissolution It is recommended to resuspend the lyophilized TGFB2 in sterile 18 M-cm H₂O to a concentration of at least 1 µg/40 µL, after which it may be further diluted into other aqueous solutions.
Formulation Lyophilized from a 1 mg/mL solution in 50 mM Tris-HCl, pH 7.4.
Amino Acid Sequence HHHHHH ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS
Storage Store at room temperature for 3 weeks, or in a dry environment at -18°C or below. After reconstitution, store at 4°C for 2-7 days; thereafter, store at -18°C or below for future use. Avoid repeated freeze-thaw cycles.
Online Inquiry
For Research or Industrial Raw Materials, Not For Personal Medical Use!
Place the Order
FAQs
logo

Enter your email here to subscribe.

Copyright © MATEXCEL. All Rights Reserved.
0
Inquiry Basket