We can offer a discount on bulk orders. Please contact our sales team for further inquiry.
Product Infomation
Product Name Recombinant Human Hepatocyte Growth Factor B Chain
Catalog Number HGF-002
Size 2µg;10µg
Description Hepatocyte growth factor (HGF) is a multifunctional growth factor that regulates cell growth and cell migration. It exhibits strong mitogenic activity on hepatocytes and primary epithelial cells. HGF acts synergistically with interleukin-3 (IL-3) and granulocyte-macrophage colony-stimulating factor (GM-CSF) to stimulate colony formation in hematopoietic progenitor cells in vitro, and may therefore also regulate the hematopoietic process. HGF is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69 kDa α-chain and a 34 kDa β-chain. The disulfide bond linking the α-chain and β-chain forms an active heterodimeric molecule.
Application This product can be used for research on studying HGF beta chain-specific signaling in tissue engineering with human HGF B chain.
Molecular Weight 34 kDa
Species Human
Source E.coli
Appearance Sterile-filtered colorless solution
Purity ≥ 95% by SDS-PAGE
Formulation The HGF-B protein is formulated in 25 mM sodium acetate, pH 4.8, 1 mM EDTA, and 50% glycerol.
Amino Acid Sequence VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Storage Store at 4°C for 2-4 weeks. For long-term storage, freeze at -20°C. For long-term storage, we recommend adding a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
Online Inquiry
For Research or Industrial Raw Materials, Not For Personal Medical Use!
Place the Order
FAQs
logo

Enter your email here to subscribe.

Copyright © MATEXCEL. All Rights Reserved.
0
Inquiry Basket