CD164 (Recombinant)
Catalog No: PT015
Size: 0.1 mL
Online Inquiry
| Product Description | CD164 (Sialomucins) belongs to a heterogeneous group of secreted or membrane-associated mucins that appear to play two key but opposing roles in vivo: 1) as cytoprotective or anti-adhesive agents and 2) as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor. Recombinant CD164 protein may serve as coating matrix protein for studying of hematopoietic stem cell (HSC) functions in vitro. |
| State | Solution |
| Concentration | 0.5 mg/mL |
| Purity | > 90% |
| Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol |
| Sterilization Method | Filtration |
| Storage/Stability | -20 °C |
| Shelf Life | Minimum of 6 months from date of receipt |
| Accession Number | NP_006007 |
| Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD |
! For Research/Industry Use Only!