CD274 (Recombinant)
Catalog No: PT017
Size: 0.2 mL
Online Inquiry
| Product Description | Human CD274 (programmed cell death 1 ligand 1) is a cell membrane protein which is involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. Recent data indicated that cancer cells that express PDL1 promote tumor progression through inhibition of PD1-expressing immune effectors. In addition, PDL1 modulates cell-mediated immunity in the infectious disease setting. |
| State | Solution |
| Concentration | 0.5 mg/mL |
| Purity | > 90% |
| Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol |
| Sterilization Method | Filtration |
| Storage/Stability | -20 °C |
| Shelf Life | Minimum of 6 months from date of receipt |
| Accession Number | NP_054862.1 |
| Sequence | MASMTGGQQMGRGHHHHHHGNLYFQG^GEFFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
! For Research/Industry Use Only!