CD270 (Recombinant)
                                Catalog No: PT016   
                                                                    Size: 0.2 mL
                                                            
                            Online Inquiry
                        | Product Description | The protein encoded by human tumor necrosis factor receptor superfamily member 14 (TNFRSF14, CD270) gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. | 
| State | Solution | 
| Concentration | 0.5 mg/mL | 
| Purity | > 90% | 
| Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol | 
| Sterilization Method | Filtration | 
| Storage/Stability | -20 °C | 
| Shelf Life | Minimum of 6 months from date of receipt | 
| Accession Number | NP_003811.2 | 
| Sequence | MASMTGGQQMGRGHHHHHHGNLYFQG^GEFLPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWV | 
                            ! For Research/Industry Use Only!